General Information

  • ID:  hor003823
  • Uniprot ID:  P87352(230-263)
  • Protein name:  Beta-endorphin
  • Gene name:  pomc
  • Organism:  Acipenser transmontanus (White sturgeon)
  • Family:  POMC family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Acipenser (genus), Acipenserini (tribe), Acipenserinae (subfamily), Acipenseridae (family), Acipenseroidei (suborder), Acipenseriformes (order), Chondrostei (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YGGFMKSWDERSQKPLLTLFKNVMIKDGHEKKGQ
  • Length:  34(230-263)
  • Propeptide:  MLHPVWGCVVAVMGVLWFYSSGVQSQCWEHSQCRDLASEANILECIQACKVDLSAESPLFPGNGHLQPTSEDIQNYVMSHFHWNTFGQRMNGTPGGSKREGASTALSVLLEALSQPRDEVERESEEEEGLQQHRRDDKRSYSMEHFRWGKPVGRKRRPVKVYPNGVEEESAESYPAEIRRDLSLKLDYPQGEELEEVFGGENDLLNLQKKDGSYKMNHFRWSGPPKDKRYGGFMKSWDERSQKPLLTLFKNVMIK
  • Signal peptide:  MLHPVWGCVVAVMGVLWFYSSGVQS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [Corticotropin]: Stimulates the adrenal glands to release cortisol.; [Melanocyte-stimulating hormone alpha]: Anorexigenic peptide. Increases the pigmentation of skin by increasing melanin production in melanocytes.; [Melanocyte-stimulating hormone beta]:
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P87352-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003823_AF2.pdbhor003823_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 458644 Formula: C180H283N49O50S2
Absent amino acids: AC Common amino acids: K
pI: 10.29 Basic residues: 8
Polar residues: 9 Hydrophobic residues: 8
Hydrophobicity: -99.41 Boman Index: -7070
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 54.41
Instability Index: 1779.41 Extinction Coefficient cystines: 6990
Absorbance 280nm: 211.82

Literature

  • PubMed ID:  9016801
  • Title:  Sturgeon Proopiomelanocortin Has a Remnant of Gamma-Melanotropin